PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31835.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 354aa    MW: 39997.8 Da    PI: 6.0872
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31835.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  mrna31835.1-v1.0-hybrid 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                             788*******************************************97 PP

2Myb_DNA-binding537.8e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
  mrna31835.1-v1.0-hybrid  67 RGRFTPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                              89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466894.87E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-251568IPR009057Homeodomain-like
CDDcd001677.88E-121761No hitNo description
PROSITE profilePS5129425.71262116IPR017930Myb domain
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.8E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2569116IPR009057Homeodomain-like
CDDcd001672.59E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPS  120
PPSSISTATS TVAPFAQMGY NDSTQQLDFV SQDYIASKPH AQDQTLFSSS ACPMFMFDTT  180
AIDQLPSENY NARVELFQDM VSSAVGFSNS DVPWNLNQHQ VQALPPPPPP AMDINYLPPL  240
IENMDSMLPI IDDHHHQVLH PNNCSNMDME ERDHHHHQDQ MAELNEWVVS QQQYSSSCPS  300
FLFWDEMNGV VGDHQGPGAI NIIGEDHHNI IVPATSSTTE ANTVLLSSYP SSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2295751e-111KP229575.1 UNVERIFIED: Boehmeria nivea MYB transcription factor-like (MYB19) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463920.10.0PREDICTED: transcription factor MYB86
TrEMBLM5WPP31e-148M5WPP3_PRUPE; Uncharacterized protein
STRINGVIT_02s0025g00320.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.14e-85myb domain protein 103